| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Myosin Heavy Chain 1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Myosin Heavy Chain 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin Heavy Chain 1. This antibody reacts with human. The Myosin Heavy Chain 1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide corresponding to Myosin heavy chain 1 (myosin, heavy chain 1, skeletal muscle, adult) directed towards the N terminal of Myosin heavy chain 1. Peptide sequence: KTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPK. |
|---|
| Other Names | DFNA4, FLJ13881, FLJ43092, KIAA2034DKFZp667A1311, MHC16, MYH14 variant protein, MYH17, myosin, Myosin heavy chain 14, Myosin heavy chain, non-muscle IIc, myosin, heavy chain 14, myosin, heavy chain 14, non-muscle, myosin, heavy polypeptide 14, myosin-14, NMHC II-C, NMHC-II-C, nonmuscle myosin heavy chain II-C, Non-muscle myosin heavy chain IIc |
|---|
| Gene, Accession # | MYH1, Gene ID: 79784, Accession: P12882, SwissProt: P12882 |
|---|
| Catalog # | NBP1-57681 |
|---|
| Price | |
|---|
| Order / More Info | Myosin Heavy Chain 1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|