| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PYK2/FAK2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization, Use PFA/Triton X-100. Western Blot verified by a customer review. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PYK2/FAK2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PYK2/FAK2. This antibody reacts with human, rat. The PYK2/FAK2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat PYK2/FAK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPM |
|---|
| Other Names | CADTKCAK-beta, CAK beta, CAKB, Calcium-dependent tyrosine kinase, Cell adhesion kinase beta, EC 2.7.10, FADK2, FAK2EC 2.7.10.2, Focal adhesion kinase 2, PKB, Proline-rich tyrosine kinase 2, protein kinase B, protein tyrosine kinase 2 beta, protein-tyrosine kinase 2-beta, PTK, PTK2B protein tyrosine kinase 2 beta, PYK2Related adhesion focal tyrosine kinase, RAFTKFADK 2 |
|---|
| Gene, Accession # | PTK2B, Gene ID: 2185 |
|---|
| Catalog # | NBP1-91228 |
|---|
| Price | |
|---|
| Order / More Info | PYK2/FAK2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 28228260 |
|---|
| 产品资料 |
|
|