| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Lactate Dehydrogenase C |
|---|
| Clone | 2C8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence. This antibody is reactive against recombinant protein in ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Lactate Dehydrogenase C Antibody (2C8) from Novus Biologicals is a mouse monoclonal antibody to Lactate Dehydrogenase C. This antibody reacts with human. The Lactate Dehydrogenase C Antibody (2C8) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | LDHC (NP_002292.1, 71 a.a. - 160 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIG |
|---|
| Other Names | Cancer/testis antigen 32, CT32EC 1.1.1.27, EC 1.1.1, lactate dehydrogenase C, lactate dehydrogenase C4, LDH testis subunit, LDH3MGC111073, LDH-C, LDHX, LDH-X, L-lactate dehydrogenase C chain |
|---|
| Gene, Accession # | LDHC, Gene ID: 3948, Accession: NP_002292.1, SwissProt: NP_002292.1 |
|---|
| Catalog # | H00003948-M01 |
|---|
| Price | |
|---|
| Order / More Info | Lactate Dehydrogenase C Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|