| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Activin RIB/ALK-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Activin RIB/ALK-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Activin RIB/ALK-4. This antibody reacts with human. The Activin RIB/ALK-4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Activin RIB/ALK-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL |
|---|
| Other Names | activin A receptor, type IB, Activin receptor type IB, Activin receptor-like kinase 4, ACTRIB, ACVRLK4ACTR-IB, ALK-4, ALK4activin A receptor, type II-like kinase 4, EC 2.7.11, EC 2.7.11.30, Serine/threonine-protein kinase receptor R2, SKR2activin receptor type-1B |
|---|
| Gene, Accession # | ACVR1B, Gene ID: 91, Accession: P36896, SwissProt: P36896 |
|---|
| Catalog # | NBP2-39003 |
|---|
| Price | |
|---|
| Order / More Info | Activin RIB/ALK-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|