| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AKAP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AKAP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AKAP3. This antibody reacts with human. The AKAP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AKAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERP |
|---|
| Other Names | A kinase (PRKA) anchor protein 3, AKAP110AKAP 110, AKAP-3, A-kinase anchor protein 110 kDa, Cancer/testis antigen 82, CT82A-kinase anchor protein 3, Fibrous sheath protein of 95 kDa, fibrousheathin 1, Fibrousheathin I, Fibrousheathin-1, FSP95A-kinase anchor protein, 110kDa, PRKA3, protein kinase A anchoring protein 3, Protein kinase A-anchoring protein 3, SOB1fibrous sheath protein, 95kDa, Sperm oocyte-binding protein, sperm oocyte-binding protein 1 |
|---|
| Gene, Accession # | AKAP3, Gene ID: 10566 |
|---|
| Catalog # | NBP1-89173 |
|---|
| Price | |
|---|
| Order / More Info | AKAP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|