| Edit |   |
| Antigenic Specificity | MYBPH |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MYBPH Antibody from Novus Biologicals is a rabbit polyclonal antibody to MYBPH. This antibody reacts with human. The MYBPH Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to MYBPH(myosin binding protein H) The peptide sequence was selected from the N terminal of MYBPH (NP_004988). Peptide sequence LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP. |
| Other Names | H-protein, myBP-H, myosin binding protein H, myosin-binding protein H |
| Gene, Accession # | MYBPH, Gene ID: 4608, Accession: Q13203, SwissProt: Q13203 |
| Catalog # | NBP1-59131 |
| Price | |
| Order / More Info | MYBPH Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |