| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRRC2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRRC2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRRC2B. This antibody reacts with human. The PRRC2B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human PRRC2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSFSASLGRAGGVSAQRDLFEERGEEYLSAFDKKAQADFDSCISSQRIGQELLFPPQENVQDAGAPGGHTQNLRCSPLEPDFVPDEKKPECGSWDVSHQP |
|---|
| Other Names | BAT2L, DKFZp781F05101, HLA-B associated transcript 2-like 1, HLA-B-associated transcript 2-like 1, LQFBS-1, MGC10526, proline-rich coiled-coil 2B, proline-rich coiled-coil protein 2B, protein BAT2-like 1, protein PRRC2B |
|---|
| Gene, Accession # | PRRC2B, Gene ID: 84726 |
|---|
| Catalog # | NBP2-57275 |
|---|
| Price | |
|---|
| Order / More Info | PRRC2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|