| Edit |   |
|---|
| Antigenic Specificity | PRRG3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRRG3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRRG3. This antibody reacts with human. The PRRG3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PRRG3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVFENKEKTMEFWKGYPNAVYSVRDPSQSSDAMY |
|---|
| Other Names | PRGP3MGC156177, proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane), Proline-rich gamma-carboxyglutamic acid protein 3, Proline-rich Gla protein 3, TMG3MGC149510, transmembrane gamma-carboxyglutamic acid protein 3 |
|---|
| Gene, Accession # | PRRG3, Gene ID: 79057, Accession: Q9BZD7, SwissProt: Q9BZD7 |
|---|
| Catalog # | NBP2-31832 |
|---|
| Price | |
|---|
| Order / More Info | PRRG3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|