| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRR14L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRR14L Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRR14L. This antibody reacts with human. The PRR14L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PRR14L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASTVDFLKIKKSCEENVCRSLKDCEMEKCPDSCAHEMESVADHEPNKRILGRVNLSLNDSHYGQQDKGTSLRETQEMTEGSRLEPNSEFGKEST |
|---|
| Other Names | C22orf30, FLJ23059, FLJ31368, FLJ33247, MGC50372, proline rich 14-like, protein PRR14L |
|---|
| Gene, Accession # | PRR14L, Gene ID: 253143, Accession: Q5THK1, SwissProt: Q5THK1 |
|---|
| Catalog # | NBP2-38968 |
|---|
| Price | |
|---|
| Order / More Info | PRR14L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|