| Edit |   |
| Antigenic Specificity | SUMO-interacting Motif (SIM) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SUMO-interacting Motif (SIM) Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUMO-interacting Motif (SIM). This antibody reacts with human. The SUMO-interacting Motif (SIM) Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SUMO-interacting Motif (SIM) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MKIQQLHPANAKTVEWDWKLLTYVMEEEGQTLPGRVLFLRYVVQTLEDDFQQTLRRQRQHLQQSIANMVLSCDKQPHNVRDVIKWLVKA |
| Other Names | Chromosome 5 Open Reading Frame 25, Oocyte Maturation Associated 1, OOMA1, Platform Element For Inhibition Of Autolytic Degradation, PLEIAD, SIMC1, SUMO-Interacting Motif-Containing Protein 1, SUMO-Interacting Motifs Containing 1 |
| Gene, Accession # | SIMC1, Gene ID: 375484, Accession: Q8NDZ2, SwissProt: Q8NDZ2 |
| Catalog # | NBP2-30700 |
| Price | |
| Order / More Info | SUMO-interacting Motif (SIM) Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |