| 产品详情 |
| Edit |   |
| Antigenic Specificity | Reg3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Reg3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Reg3A. This antibody reacts with human. The Reg3A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Reg3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KAYGSHCYALFLSPKSWTDADLACQKRPSGNL |
| Other Names | hepatocarcinoma-intestine-pancreas, HIPpancreatitis-associated protein, Human proislet peptide, pancreatic beta cell growth factor, Pancreatitis-associated protein 1, PAP homologous protein, PAP1FLJ18565, PAPPAP-H, PBCGF, proliferation-inducing protein 34, proliferation-inducing protein 42, Reg III-alpha, REG3, REG-3-alpha, regenerating islet-derived 3 alpha, regenerating islet-derived protein 3-alpha, Regenerating islet-derived protein III-alpha, REG-III |
| Gene, Accession # | REG3A, Gene ID: 5068 |
| Catalog # | NBP2-48903 |
| Price | |
| Order / More Info | Reg3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|