| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GluR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GluR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GluR1. This antibody reacts with human. The GluR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GluR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN |
|---|
| Other Names | AMPA 1, AMPA-selective glutamate receptor 1, GluA1, GLUH1, GluR-1, GLUR1gluR-A, GluR-A, GLURA, GluR-K1, glutamate receptor 1, Glutamate receptor ionotropic, AMPA 1, glutamate receptor, ionotropic, AMPA 1, HBGR1, MGC133252 |
|---|
| Gene, Accession # | GRIA1, Gene ID: 2890, Accession: P42261, SwissProt: P42261 |
|---|
| Catalog # | NBP2-33996 |
|---|
| Price | |
|---|
| Order / More Info | GluR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|