| 产品详情 |
| Edit |   |
| Antigenic Specificity | RMND1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RMND1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RMND1. This antibody reacts with human. The RMND1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RMND1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RRVTHKPNLLGSKWFIKILKRHFSSVSTETFVPKQDFPQVKRPLKASRTRQPSRTNLPVLSVNEDLMHCTAFATADEYHLGNLSQ |
| Other Names | bA351K16, bA351K16.3, C6orf96, chromosome 6 open reading frame 96, FLJ20627, MGC117362, MGC149570, MGC88260, required for meiotic nuclear division 1 homolog (S. cerevisiae), required for meiotic nuclear division protein 1 homolog, RMD1 |
| Gene, Accession # | RMND1, Gene ID: 55005, Accession: Q9NWS8, SwissProt: Q9NWS8 |
| Catalog # | NBP2-33951 |
| Price | |
| Order / More Info | RMND1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|