| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RMND5A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, amphibian |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RMND5A Antibody from Novus Biologicals is a rabbit polyclonal antibody to RMND5A. This antibody reacts with human, mouse, amphibian. The RMND5A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, amphibian RMND5A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE |
|---|
| Other Names | C-terminal to LisH motif, 44 kDa, CTLH, FLJ12753, FLJ13910, FLJ21795, MGC78451, p44CTLH, protein RMD5 homolog A, required for meiotic nuclear division 5 homolog A (S. cerevisiae), RMD5 |
|---|
| Gene, Accession # | RMND5A, Gene ID: 64795 |
|---|
| Catalog # | NBP1-92337 |
|---|
| Price | |
|---|
| Order / More Info | RMND5A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25793641, 28668087, 30795516 |
|---|
| 产品资料 |
|
|