| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UbcH7/UBE2L3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UbcH7/UBE2L3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UbcH7/UBE2L3. This antibody reacts with human, mouse, rat. The UbcH7/UBE2L3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat UbcH7/UBE2L3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFK |
|---|
| Other Names | E2-F1, EC 6.3.2.19, L-UBC, UBCE7, UbcH7, UBCH7UbcM4, Ubiquitin carrier protein L3, ubiquitin-conjugating enzyme E2 L3, Ubiquitin-conjugating enzyme E2-F1, ubiquitin-conjugating enzyme E2L 3, ubiquitin-conjugating enzyme UBCH7, Ubiquitin-protein ligase L3 |
|---|
| Gene, Accession # | UBE2L3, Gene ID: 7332 |
|---|
| Catalog # | NBP1-92557 |
|---|
| Price | |
|---|
| Order / More Info | UbcH7/UBE2L3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|