| Edit |   |
| Antigenic Specificity | CHM |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CHM Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHM. This antibody reacts with human. The CHM Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human CHMThe immunogen for this antibody is CHM. Peptide sequence LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE. |
| Other Names | choroideraemia protein, choroideremia (Rab escort protein 1), Rab geranylgeranyltransferase component A, rab proteins geranylgeranyltransferase component A 1, REP1 |
| Gene, Accession # | CHM, Gene ID: 1121, Accession: NP_000381, SwissProt: NP_000381 |
| Catalog # | NBP1-79946-20ul |
| Price | |
| Order / More Info | CHM Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |