| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CHMP5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CHMP5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CHMP5. This antibody reacts with human. The CHMP5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CHMP5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELD |
|---|
| Other Names | apoptosis-related protein PNAS-2, C9orf83, charged multivesicular body protein 5, chromatin modifying protein 5, Chromatin-modifying protein 5, chromosome 9 open reading frame 83, HSPC177, hVps60, PNAS-2, SNF7 domain containing 2, SNF7 domain-containing protein 2, SNF7DC2, Vacuolar protein sorting-associated protein 60, Vps60CGI-34 |
|---|
| Gene, Accession # | CHMP5, Gene ID: 51510 |
|---|
| Catalog # | NBP2-49227 |
|---|
| Price | |
|---|
| Order / More Info | CHMP5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|