| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glucose Transporter GLUT6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Alexa Fluor 405 conjugate |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glucose Transporter GLUT6 Antibody [Alexa Fluor® 405] from Novus Biologicals is a rabbit polyclonal antibody to Glucose Transporter GLUT6. This antibody reacts with human. The Glucose Transporter GLUT6 Antibody [Alexa Fluor® 405] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLT |
|---|
| Other Names | Glucose transporter type 6, Glucose transporter type 9, GLUT6, GLUT-9, GLUT9GLUT-6, HSA011372, solute carrier family 2 (facilitated glucose transporter), member 6, solute carrier family 2, facilitated glucose transporter member 6 |
|---|
| Gene, Accession # | SLC2A6, Gene ID: 11182, SwissProt: Q9UGQ3 |
|---|
| Catalog # | NBP1-59891AF405 |
|---|
| Price | |
|---|
| Order / More Info | Glucose Transporter GLUT6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|