| Edit |   |
|---|
| Antigenic Specificity | Glucose Transporter GLUT8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glucose Transporter GLUT8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glucose Transporter GLUT8. This antibody reacts with human. The Glucose Transporter GLUT8 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Glucose Transporter GLUT8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRFLLTQHRRQEAMAALRFLWGSEQGWEDPPIGAEQSFHLALLRQPGIYKP |
|---|
| Other Names | GLUT-8, GLUT8solute carrier family 2 (facilitated glucose transporter) member 8, GLUTX1facilitated glucose transporter member 8, solute carrier family 2 (facilitated glucose transporter), member 8 |
|---|
| Gene, Accession # | SLC2A8, Gene ID: 29988 |
|---|
| Catalog # | NBP1-89760 |
|---|
| Price | |
|---|
| Order / More Info | Glucose Transporter GLUT8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|