| Edit |   |
|---|
| Antigenic Specificity | Glucose Transporter GLUT8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glucose Transporter GLUT8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glucose Transporter GLUT8. This antibody reacts with human. The Glucose Transporter GLUT8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC2A8 (solute carrier family 2, facilitated glucose transporter, member 8). The peptide sequence was selected from the middle region of SLC2A8. Peptide sequence VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPV |
|---|
| Other Names | GLUT-8, GLUT8solute carrier family 2 (facilitated glucose transporter) member 8, GLUTX1facilitated glucose transporter member 8, solute carrier family 2 (facilitated glucose transporter), member 8 |
|---|
| Gene, Accession # | SLC2A8, Gene ID: 29988, Accession: Q9NY64, SwissProt: Q9NY64 |
|---|
| Catalog # | NBP1-59812 |
|---|
| Price | |
|---|
| Order / More Info | Glucose Transporter GLUT8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|