| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Glucosylceramidase/GBA |
|---|
| Clone | 2H4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glucosylceramidase/GBA Antibody (2H4) from Novus Biologicals is a mouse monoclonal antibody to Glucosylceramidase/GBA. This antibody reacts with human. The Glucosylceramidase/GBA Antibody (2H4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | GBA (NP_000148 146 a.a. - 235 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS |
|---|
| Other Names | Acid beta-glucosidase, alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine glucohydrolase, EC 3.2.1.45, GBA1, GC, GCB, GLUC, glucosidase, beta, acid, glucosidase, beta; acid (includes glucosylceramidase), glucosylceramidase, imiglucerase, lysosomal glucocerebrosidase |
|---|
| Gene, Accession # | GBA, Gene ID: 2629, Accession: NP_000148, SwissProt: NP_000148 |
|---|
| Catalog # | H00002629-M03 |
|---|
| Price | |
|---|
| Order / More Info | Glucosylceramidase/GBA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|