| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KAP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KAP1. This antibody reacts with human. The KAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV |
|---|
| Other Names | E3 SUMO-protein ligase TRIM28, EC 6.3.2.-, FLJ29029, KAP-1, KAP1KRAB-associated protein 1, KRIP-1, Nuclear corepressor KAP-1, RNF96KRAB-interacting protein 1, TF1B, TIF1-beta, TIF1BRING finger protein 96, transcription intermediary factor 1-beta, transcriptional intermediary factor 1-beta, tripartite motif containing 28, tripartite motif-containing 28, Tripartite motif-containing protein 28 |
|---|
| Gene, Accession # | TRIM28, Gene ID: 10155, Accession: Q13263, SwissProt: Q13263 |
|---|
| Catalog # | NBP2-39014 |
|---|
| Price | |
|---|
| Order / More Info | KAP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|