| Edit |   |
| Antigenic Specificity | LDLRAD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The LDLRAD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LDLRAD4. This antibody reacts with human. The LDLRAD4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LDLRAD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HYKVSTRSFINRPNQSRRREDGLPQEGCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQ |
| Other Names | C18orf1, chromosome 18 open reading frame 1, clone 22, hypothetical protein LOC753 |
| Gene, Accession # | LDLRAD4, Gene ID: 753, Accession: O15165, SwissProt: O15165 |
| Catalog # | NBP2-38061 |
| Price | |
| Order / More Info | LDLRAD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |