| 产品详情 |
| Edit |   |
| Antigenic Specificity | GASP-2/WFIKKN |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GASP-2/WFIKKN Antibody from Novus Biologicals is a rabbit polyclonal antibody to GASP-2/WFIKKN. This antibody reacts with human. The GASP-2/WFIKKN Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GASP-2/WFIKKN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PNMTAGDGPLVIMGEVRDGVAVLDAGSYVRAASEKRVKKILELLEKQACELLNRFQD |
| Other Names | C16orf12, Chromosome 16 Open Reading Frame 12, GASP2, GASP-2, Growth And Differentiation Factor-Associated Serum Protein 2, hGASP-2, RJD2, WAP Four-Disulfide Core Domain 20A, WAP, Follistatin/Kazal, Immunoglobulin, Kunitz And Netrin Domain Containing 1, WAP, FS, Ig, KU, And NTR-Containing Protein, WFDC20A, WFIKKN |
| Gene, Accession # | WFIKKN1, Gene ID: 117166, Accession: Q96NZ8, SwissProt: Q96NZ8 |
| Catalog # | NBP2-37904 |
| Price | |
| Order / More Info | GASP-2/WFIKKN Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|