| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP4A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP4A. This antibody reacts with human. The ATP4A Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQ |
|---|
| Other Names | ATP6Agastric H, ATPase, H+/K+ exchanging, alpha polypeptide, ATPase, H+/K+ transporting, alpha polypeptide, EC 3.6.3, EC 3.6.3.10, gastric H, Gastric H(+)/K(+) ATPase subunit alpha, gastric H+/K+ ATPase alpha subunit, gastric hydrogen-potassium ATPase, H(+)-K(+)-ATPase alpha subunit, K-ATPase alpha subunit, K-ATPase catalytic subunit, potassium-transporting ATPase alpha chain 1, Proton pump |
|---|
| Gene, Accession # | ATP4A, Gene ID: 495 |
|---|
| Catalog # | NBP1-88889 |
|---|
| Price | |
|---|
| Order / More Info | ATP4A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|