| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RAP30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAP30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAP30. This antibody reacts with human. The RAP30 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNP |
|---|
| Other Names | BTF4, General transcription factor IIF 74 kDa subunit, general transcription factor IIF subunit 1, general transcription factor IIF, polypeptide 1 (74kD subunit), general transcription factor IIF, polypeptide 1, 74kDa, RAP74Transcription initiation factor RAP74, TF2F1, TFIIF, TFIIF-alpha, Transcription initiation factor IIF subunit alpha |
|---|
| Gene, Accession # | GTF2F1, Gene ID: 2962 |
|---|
| Catalog # | NBP2-68907 |
|---|
| Price | |
|---|
| Order / More Info | RAP30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|