| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFV2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFV2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFV2. This antibody reacts with human. The NDUFV2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human NDUFV2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY',) |
|---|
| Other Names | CI-24k, mitochondrial respitory chain, 24 kD subunit, NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD), NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa, NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial, NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial, NADH-ubiquinone oxidoreductase 24 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 2, nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit |
|---|
| Gene, Accession # | NDUFV2, Gene ID: 4729 |
|---|
| Catalog # | NBP2-58837 |
|---|
| Price | |
|---|
| Order / More Info | NDUFV2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|