| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFV2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFV2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFV2. This antibody reacts with mouse. The NDUFV2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human Ndufv2The immunogen for this antibody is Ndufv2. Peptide sequence DNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPK. |
|---|
| Other Names | CI-24k, mitochondrial respitory chain, 24 kD subunit, NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD), NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa, NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial, NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial, NADH-ubiquinone oxidoreductase 24 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 2, nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit |
|---|
| Gene, Accession # | NDUFV2, Gene ID: 4729, Accession: NP_082664 |
|---|
| Catalog # | NBP1-79680 |
|---|
| Price | |
|---|
| Order / More Info | NDUFV2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|