| 产品详情 |
| Edit |   |
| Antigenic Specificity | NDUFV3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NDUFV3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFV3. This antibody reacts with human. The NDUFV3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NDUFV3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP |
| Other Names | CI-10k, CI-9KD, complex I 10kDa subunit, complex I, mitochondrial respiratory chain, 10-kD subunit, Complex I-9kD, mitochondrial NADH oxidoreductase-like protein, NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD), NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa, NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial, NADH-ubiquinone oxidoreductase 9 kD subunit, NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD, NADH-ubiquinone oxidoreductase 9 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD, Renal carcinoma antigen NY-REN-4 |
| Gene, Accession # | NDUFV3, Gene ID: 4731 |
| Catalog # | NBP1-85621 |
| Price | |
| Order / More Info | NDUFV3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|