| Edit |   |
| Antigenic Specificity | KLHDC9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLHDC9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHDC9. This antibody reacts with mouse. The KLHDC9 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is Klhdc9. Peptide sequence HHSCSVVGPFAVLFGGETLTRARDTICNDLYIYDTRKSPPLWFHFPSTDR. |
| Other Names | KARCA1Kelch/ankyrin repeat-containing cyclin A1-interacting protein, kelch domain containing 9, kelch domain-containing protein 9, MGC33338, RP11-544M22.9 |
| Gene, Accession # | KLHDC9, Gene ID: 126823, Accession: NP_001028211 |
| Catalog # | NBP1-79471-20ul |
| Price | |
| Order / More Info | KLHDC9 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |