| Edit |   |
|---|
| Antigenic Specificity | KLHDC8A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KLHDC8A Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHDC8A. This antibody reacts with human. The KLHDC8A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to KLHDC8A (kelch domain containing 8A) The peptide sequence was selected from the C terminal of KLHDC8A. Peptide sequence PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS. |
|---|
| Other Names | FLJ10748, kelch domain containing 8A, kelch domain-containing protein 8A |
|---|
| Gene, Accession # | KLHDC8A, Gene ID: 55220, Accession: Q8IYD2, SwissProt: Q8IYD2 |
|---|
| Catalog # | NBP1-57422 |
|---|
| Price | |
|---|
| Order / More Info | KLHDC8A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|