| Edit |   |
| Antigenic Specificity | KLHDC8A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KLHDC8A Antibody from Novus Biologicals is a rabbit polyclonal antibody to KLHDC8A. This antibody reacts with human. The KLHDC8A Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KLHDC8A(kelch domain containing 8A) The peptide sequence was selected from the middle region of KLHDC8A. Peptide sequence NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQG. |
| Other Names | FLJ10748, kelch domain containing 8A, kelch domain-containing protein 8A |
| Gene, Accession # | KLHDC8A, Gene ID: 55220, Accession: Q8IYD2, SwissProt: Q8IYD2 |
| Catalog # | NBP1-57421 |
| Price | |
| Order / More Info | KLHDC8A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |