| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dishevelled-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry-Paraffin. A band is observed at 38kDa by Western Blot. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25975243) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Dishevelled-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Dishevelled-1. This antibody reacts with human. The Dishevelled-1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to DVL1(dishevelled, dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK. |
|---|
| Other Names | dishevelled 1 (homologous to Drosophila dsh), dishevelled, dsh homolog 1 (Drosophila), Dishevelled-1, DSH homolog 1, DVL, DVL1L1, MGC54245, segment polarity protein dishevelled homolog DVL-1 |
|---|
| Gene, Accession # | DVL1, Gene ID: 1855 |
|---|
| Catalog # | NBP1-58317 |
|---|
| Price | |
|---|
| Order / More Info | Dishevelled-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25975243 |
|---|
| 产品资料 |
|
|