| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP2C1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP2C1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP2C1. This antibody reacts with human. The ATP2C1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP2C1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AIASRLGLYSKTSQSVSGEEIDAMDVQQLSQIVPKVAVFYRASPRHKMKIIKSLQKNGSVVAMTGD |
|---|
| Other Names | ATPase, Ca++ transporting, type 2C, member 1, BCPM, benign chronic pemphigus (Hailey-Hailey disease), Ca(2+)-sequestering, calcium-transporting ATPase type 2C member 1, EC 3.6.3, HHD, hSPCA1, HUSSY-28, PMR1L, secretory pathway Ca2+/Mn2+ ATPase 1 |
|---|
| Gene, Accession # | ATP2C1, Gene ID: 27032 |
|---|
| Catalog # | NBP1-88887 |
|---|
| Price | |
|---|
| Order / More Info | ATP2C1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|