| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP2C2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP2C2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP2C2. This antibody reacts with human. The ATP2C2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP2C2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFCVDLH TGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ |
|---|
| Other Names | ATPase 2C2, ATPase, Ca++ transporting, type 2C, member 2, calcium-transporting ATPase type 2C member 2, DKFZp686H22230, KIAA0703, secretory pathway Ca(2+)-ATPase 2, secretory pathway calcium ATPase 2, SPCA2 |
|---|
| Gene, Accession # | ATP2C2, Gene ID: 9914 |
|---|
| Catalog # | NBP2-14329 |
|---|
| Price | |
|---|
| Order / More Info | ATP2C2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|