| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATP Citrate Lyase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATP Citrate Lyase Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP Citrate Lyase. This antibody reacts with human, mouse, rat. The ATP Citrate Lyase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human, mouse, rat ATP Citrate Lyase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPF |
| Other Names | ACLEC 2.3.3.8, ATP citrate lyase, ATP citrate synthase, ATP-citrate (pro-S-)-lyase, ATP-citrate synthase, ATPCL, Citrate cleavage enzyme, CLATP |
| Gene, Accession # | ACLY, Gene ID: 47 |
| Catalog # | NBP1-90269 |
| Price | |
| Order / More Info | ATP Citrate Lyase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|