| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | 58K Golgi Protein |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 58K Golgi Protein Antibody from Novus Biologicals is a rabbit polyclonal antibody to 58K Golgi Protein. This antibody reacts with human. The 58K Golgi Protein Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to FTCD(formiminotransferase cyclodeaminase) The peptide sequence was selected from the N terminal of FTCD (NP_006648). Peptide sequence FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE. |
|---|
| Other Names | formimidoyltransferase cyclodeaminase, formimidoyltransferase-cyclodeaminase, formiminotransferase cyclodeaminase, Formiminotransferase-cyclodeaminase, human formiminotransferase cyclodeaminase, EC 4.3.1.410formiminotransferase-cyclodeaminase, LCHC1 |
|---|
| Gene, Accession # | FTCD, Gene ID: 10841, Accession: O95954, SwissProt: O95954 |
|---|
| Catalog # | NBP1-54997-20ul |
|---|
| Price | |
|---|
| Order / More Info | 58K Golgi Protein Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|