| Edit |   |
|---|
| Antigenic Specificity | KHDC4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KHDC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KHDC4. This antibody reacts with human. The KHDC4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to KIAA0907(KIAA0907) The peptide sequence was selected from the middle region of KIAA0907. Peptide sequence ELPDERESGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERER. |
|---|
| Other Names | BLOM7, KIAA0907, nuclear ribonucleoprotein K homology domain protein, RP11-336K24.1 |
|---|
| Gene, Accession # | KIAA0907, Gene ID: 22889, Accession: Q7Z7F0, SwissProt: Q7Z7F0 |
|---|
| Catalog # | NBP1-56565-20ul |
|---|
| Price | |
|---|
| Order / More Info | KHDC4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|