| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KHDRBS3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KHDRBS3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KHDRBS3. This antibody reacts with human. The KHDRBS3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human KHDRBS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS |
|---|
| Other Names | Etle, etoile, KH domain containing, RNA binding, signal transduction associated 3, SALPRNA-binding protein T-Star, Sam68-like mammalian protein 2, Sam68-like phosphotyrosine protein, Sam68-like phosphotyrosine protein, T-STAR, SLM-2KH domain-containing, RNA-binding, signal transduction-associated protein 3, SLM2TSTAR, T-STAR |
|---|
| Gene, Accession # | KHDRBS3, Gene ID: 10656 |
|---|
| Catalog # | NBP2-55220 |
|---|
| Price | |
|---|
| Order / More Info | KHDRBS3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|