| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KHSRP |
|---|
| Clone | 4C10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KHSRP Antibody (4C10) from Novus Biologicals is a mouse monoclonal antibody to KHSRP. This antibody reacts with human. The KHSRP Antibody (4C10) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | KHSRP (NP_003676, 151 a.a. - 239 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VPDGMVGLIIGRGGEQINKIQQDSGCKVQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIM |
|---|
| Other Names | FBP2far upstream element-binding protein 2, FUBP2p75, FUSE binding protein 2, FUSE-binding protein 2, KH type-splicing regulatory protein, KH-type splicing regulatory protein, KSRPMGC99676 |
|---|
| Gene, Accession # | KHSRP, Gene ID: 8570, Accession: NP_003676, SwissProt: NP_003676 |
|---|
| Catalog # | H00008570-M01 |
|---|
| Price | |
|---|
| Order / More Info | KHSRP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|