| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RAP80 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RAP80 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAP80. This antibody reacts with human. The RAP80 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RAP80 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLRKAIAESLNSCRPSDASATRSRPLATGPSSQSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSG |
|---|
| Other Names | BRCA1-A complex subunit RAP80, RAP80X2HRIP110, receptor associated protein 80, Receptor-associated protein 80, retinoid x receptor interacting protein, Retinoid X receptor-interacting protein 110, RXRIP110, ubiquitin interaction motif containing 1, Ubiquitin interaction motif-containing protein 1 |
|---|
| Gene, Accession # | UIMC1, Gene ID: 51720, Accession: Q96RL1, SwissProt: Q96RL1 |
|---|
| Catalog # | NBP1-87156 |
|---|
| Price | |
|---|
| Order / More Info | RAP80 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24413181, 24560272, 26446986, 28604711, 29499138, 30022091, 30245011, 30480549 |
|---|
| 产品资料 |
|
|