| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHE8 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHE8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHE8. This antibody reacts with human, mouse. The NHE8 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC9A8(solute carrier family 9 (sodium/hydrogen exchanger), member 8) The peptide sequence was selected from the middle region of SLC9A8. Peptide sequence AKYLNPFFTRRLTQEDLHHGRIQMKTLTNKWYEEVRQGPSGSEDDEQE |
|---|
| Other Names | DKFZp686C03237, KIAA0939DKFZp686C03237, MGC138418, Na(+)/H(+) exchanger 8, NHE-8, NHE8FLJ42500, sodium/hydrogen exchanger 8, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 8, solute carrier family 9 (sodium/hydrogen exchanger), member 8, Solute carrier family 9 member 8 |
|---|
| Gene, Accession # | SLC9A8, Gene ID: 23315, Accession: Q2M1U9, SwissProt: Q2M1U9 |
|---|
| Catalog # | NBP1-59888-20ul |
|---|
| Price | |
|---|
| Order / More Info | NHE8 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25377912 |
|---|
| 产品资料 |
|
|