| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHE1/SLC9A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHE1/SLC9A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHE1/SLC9A1. This antibody reacts with human. The NHE1/SLC9A1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NHE1/SLC9A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG |
|---|
| Other Names | APNH1, APNHFLJ42224, Na(+)/H(+) antiporter, amiloride-sensitive, Na(+)/H(+) exchanger 1, Na+/H+, amiloride sensitive), Na-Li countertransporter, NHE-1, NHE1Na+/H+ antiporter, amiloride-sensitive, sodium/hydrogen exchanger 1, solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, solute carrier family 9 (sodium/hydrogen exchanger), member 1, solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Solute carrier family 9 member 1 |
|---|
| Gene, Accession # | SLC9A1, Gene ID: 6548, Accession: P19634, SwissProt: P19634 |
|---|
| Catalog # | NBP2-38683 |
|---|
| Price | |
|---|
| Order / More Info | NHE1/SLC9A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|