| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHE3/SLC9A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in IHC-F reported in scientific literature (PMID 26677983), Use in WB reported in scientific literature (PMID: 30030371). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHE3/SLC9A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHE3/SLC9A3. This antibody reacts with human, mouse. The NHE3/SLC9A3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human, mouse NHE3/SLC9A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST |
|---|
| Other Names | isoform 3, MGC126718, NHE3MGC126720, solute carrier family 9 (sodium/hydrogen exchanger), member 3, Solute carrier family 9 member 3 |
|---|
| Gene, Accession # | SLC9A3, Gene ID: 6550 |
|---|
| Catalog # | NBP1-82574 |
|---|
| Price | |
|---|
| Order / More Info | NHE3/SLC9A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25552580, 26677983, 29196502, 29930980, 30030371, 30095213, 30144427 |
|---|
| 产品资料 |
|
|