| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Rubicon |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Rubicon Antibody from Novus Biologicals is a rabbit polyclonal antibody to Rubicon. This antibody reacts with human. The Rubicon Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Rubicon antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS |
|---|
| Other Names | Baron, Beclin 1-interacting protein, Beclin-1 Associated RUN Domain Containing Protein, KIAA0226, Rubicon, RUN And Cysteine Rich Domain Containing Beclin 1 Interacting Protein, RUN Domain And Cysteine-Rich Domain Containing, Beclin 1-Interacting Protein, Run Domain Beclin-1-Interacting And Cysteine-Rich Domain-Containing Protein, rundataxin, SCAR15 |
|---|
| Gene, Accession # | KIAA0226, Gene ID: 9711 |
|---|
| Catalog # | NBP2-49134 |
|---|
| Price | |
|---|
| Order / More Info | Rubicon Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|