| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RUNDC3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RUNDC3B Antibody from Novus Biologicals is a rabbit polyclonal antibody to RUNDC3B. This antibody reacts with human. The RUNDC3B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RUNDC3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TPYLKYIQSSDSISSDEEELRTLGSSGSESSTPENVGPPFLMDENSWFNKCKRVKQKYQLTLEQKGYLEE |
|---|
| Other Names | Rap2 binding protein 9, Rap2-binding protein 9, Rap2-interacting protein 9, RPIB9FLJ30671, RPIP-9, RPIP9MGC26655, RUN domain containing 3B, RUN domain-containing protein 3B |
|---|
| Gene, Accession # | RUNDC3B, Gene ID: 154661, Accession: Q96NL0, SwissProt: Q96NL0 |
|---|
| Catalog # | NBP2-31654 |
|---|
| Price | |
|---|
| Order / More Info | RUNDC3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|