| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cyclin E1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 25320178). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence fixation permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cyclin E1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cyclin E1. This antibody reacts with human. The Cyclin E1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cyclin E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCADPCSLIPTPD |
|---|
| Other Names | CCNEcyclin Es, cyclin E1, cyclin Et, G1/S-specific cyclin-E1 |
|---|
| Gene, Accession # | CCNE1, Gene ID: 898 |
|---|
| Catalog # | NBP1-88153 |
|---|
| Price | |
|---|
| Order / More Info | Cyclin E1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25320178 |
|---|
| 产品资料 |
|
|