| Edit |   |
|---|
| Antigenic Specificity | Cyclin J |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cyclin J Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cyclin J. This antibody reacts with rat. The Cyclin J Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is cyclin J - C-terminal region. Peptide sequence PAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHFPCIT. |
|---|
| Other Names | bA690P14.1, cyclin J, cyclin-J, FLJ10895 |
|---|
| Gene, Accession # | CCNJ, Gene ID: 54619, Accession: NP_001099839 |
|---|
| Catalog # | NBP1-98569 |
|---|
| Price | |
|---|
| Order / More Info | Cyclin J Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|