| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-31RA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. Recommended conditions for IHC,Retrieval method: HIER pH6 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-31RA Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-31RA. This antibody reacts with human. The IL-31RA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLR |
|---|
| Other Names | class I cytokine receptor, CRL3Glmr, Cytokine receptor-like 3, GLMR, GLM-RMGC125346, GP130 like receptor, Gp130-like monocyte receptor, Gp130-like receptor, hGLM-R, IL-31 receptor subunit alpha, IL-31R subunit alpha, IL-31RAGPLCRL, IL-31R-alpha, interleukin 31 receptor A, interleukin-31 receptor subunit alpha, PRO21384, soluble type I cytokine receptor CRL3, ZcytoR17 |
|---|
| Gene, Accession # | IL31RA, Gene ID: 133396 |
|---|
| Catalog # | NBP2-68866 |
|---|
| Price | |
|---|
| Order / More Info | IL-31RA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|