| 产品详情 |
| Edit |   |
| Antigenic Specificity | IL-1 RAcP/IL-1 R3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IL-1 RAcP/IL-1 R3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-1 RAcP/IL-1 R3. This antibody reacts with human. The IL-1 RAcP/IL-1 R3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IL-1RAcP/IL-1R3/IL1RAP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF |
| Other Names | C3orf13IL-1RAcPIL1R3Interleukin-1 receptor 3, FLJ37788, IL-1 receptor accessory protein, IL-1R3, IL-1R-3, interleukin 1 receptor accessory protein, interleukin-1 receptor accessory protein, interleukin-1 receptor accessory protein beta |
| Gene, Accession # | IL1RAP, Gene ID: 3556 |
| Catalog # | NBP1-86793 |
| Price | |
| Order / More Info | IL-1 RAcP/IL-1 R3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|